PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Rsa1.0_04250.1_g00005.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
Family bZIP
Protein Properties Length: 276aa    MW: 31117.2 Da    PI: 9.4101
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Rsa1.0_04250.1_g00005.1genomeRGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_153.26.6e-17206251551
                              CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
                   bZIP_1   5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkelee 51 
                              ++++r++kNRe+A+rsR+RK+a+++eLe kv +Le+eN++L+ +l e
  Rsa1.0_04250.1_g00005.1 206 RKQKRMIKNRESASRSRARKQAYTQELEIKVSSLEEENQKLR-RLME 251
                              689**************************************9.5555 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003384.6E-9201258IPR004827Basic-leucine zipper domain
PROSITE profilePS5021711.22204251IPR004827Basic-leucine zipper domain
Gene3DG3DSA:1.20.5.1706.3E-14206248No hitNo description
PfamPF001708.2E-14206248IPR004827Basic-leucine zipper domain
SuperFamilySSF579596.88E-11206250No hitNo description
CDDcd147075.59E-20206251No hitNo description
PROSITE patternPS000360209224IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 276 aa     Download sequence    Send to blast
MGSLRGNVEE PIHQSLPRQN SLYSLKLHEV QTHFGSSSKP LGSMNLDELL KSVWSAEATQ  60
PLEGTEEGIT RQRSLTLPRG LSRKTVEDVW RDIQQDKNGC SSNNPNKQPT FGEITLEDLL  120
LKAGVVTEAM TVPQNVVNVA SNGQWAQYQH QPQHQGFMPY PVCDMQEMVS PTSFVMGGLS  180
DTPPQAHGRK RVASSGGEFV ERIVERKQKR MIKNRESASR SRARKQAYTQ ELEIKVSSLE  240
EENQKLRRLM EVEKILPSEP PPEPKWKLRR ASSASF
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009141965.11e-174PREDICTED: ABSCISIC ACID-INSENSITIVE 5-like protein 3
RefseqXP_009141966.11e-174PREDICTED: ABSCISIC ACID-INSENSITIVE 5-like protein 3
RefseqXP_009141967.11e-174PREDICTED: ABSCISIC ACID-INSENSITIVE 5-like protein 3
RefseqXP_009141968.11e-174PREDICTED: ABSCISIC ACID-INSENSITIVE 5-like protein 3
SwissprotQ9C5Q21e-137AI5L3_ARATH; ABSCISIC ACID-INSENSITIVE 5-like protein 3
TrEMBLM4DKC41e-169M4DKC4_BRARP; Uncharacterized protein
STRINGBra016953.1-P1e-168(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM18842883
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G41070.31e-129bZIP family protein